PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676734346
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family HB-other
Protein Properties Length: 521aa    MW: 58220.5 Da    PI: 7.8303
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676734346genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.6e-182176257
               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
               +kR   t+ q+ +Le+++++++yp++e+++++A++++Lte+qV+ WF+ rR k+k+
  676734346 21 KKRKLKTPIQVMALENFYNEHKYPTEEMKAKIAEEIELTEKQVSGWFCHRRLKDKR 76
               899***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-19776IPR009057Homeodomain-like
PROSITE profilePS5007116.4391777IPR001356Homeobox domain
SuperFamilySSF466892.57E-161984IPR009057Homeodomain-like
SMARTSM003893.0E-181981IPR001356Homeobox domain
CDDcd000868.10E-172177No hitNo description
PfamPF000461.8E-152176IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MLSDSGEVPA DGDKTSAENN KKRKLKTPIQ VMALENFYNE HKYPTEEMKA KIAEEIELTE  60
KQVSGWFCHR RLKDKRSGKE DGNNIGSQDR SSVVLQDRGS GLRQDSCGST KQTDYWNPKP  120
REVESQRLYG GSYMRNVDGE DSTSSERSSS LHKNLVSSKD GIRDVESSRF VAHNEHPQVM  180
RSYGYSNKPS GYLKVKGDTE NVAITAVKRQ LGRQYREDGP PLGVEFDPLP PGAFEPQTNV  240
IVQEPIYVGN QRRPHPPYFT GTRKSFIPGP SYELARKSKM HSADPYSEDD DDDDDDDDNI  300
MGGMEPGLGD KHPALDHSSL KGTFKGPPQG IPLTNNKKSR VSSESRAEGS RNNLIPNFHN  360
LSGSNIGTNQ THDHDKSIFN GGRKTGYLSK SSKMLPLSSS RSPVSMERGP SSGMVGKYHG  420
EKMNHMKMHR EKLHSTGEPQ VTKRLKHEYP QQQVYAPKPL NSDIFGLKDQ TNRLVNIIMH  480
LFPQKRGQID LWDNTYGCRS GAELPSSLSG DETEESSSSM D
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412960.0AJ441296.1 Arabidopsis thaliana mRNA for homeodomain protein 14 (hd-14 gene).
GenBankBT0263720.0BT026372.1 Arabidopsis thaliana At4g03250 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608630.10.0PREDICTED: uncharacterized protein LOC106315448
TrEMBLA0A0D3E0890.0A0A0D3E089_BRAOL; Uncharacterized protein
STRINGBra034196.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122022531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.10.0HB-other family protein